PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G66230.1
Common NameAtMYB20, MYB20, T6J19.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 282aa    MW: 32336.4 Da    PI: 4.8999
Description myb domain protein 20
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G66230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
      AT1G66230.1 14 KGPWTAEEDRKLINFILTNGQCCWRAVPKLSGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.16.2e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++  +d++ qlG++ W++Ia++++ gRt++++k++w+++
      AT1G66230.1  73 YEEKMVIDLHSQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      599*************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-20562IPR009057Homeodomain-like
PROSITE profilePS5129414.186961IPR017930Myb domain
SuperFamilySSF466891.87E-2611108IPR009057Homeodomain-like
SMARTSM007172.0E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
CDDcd001673.76E-81661No hitNo description
PROSITE profilePS5129425.04162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2463116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PfamPF002491.6E-1373111IPR001005SANT/Myb domain
CDDcd001675.98E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005352anatomyxylem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDRKLINFIL TNGQCCWRAV PKLSGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDYEEKMVID LHSQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLS IVEKEDEEPL KKLQNNTVPF QETMERPLEN NIKNISRLEE SLGDDQFMEI  180
NLEYGVEDVP LIETESLDLI CSNSTMSSST STSSHSSNDS SFLKDLQFPE FEWSDYGNSN  240
NDNNNGVDNI IENNMMSLWE ISDFSSLDLL LNDESSSTFG LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109010.0cell culture| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306973180.0
Genevisible259822_at0.0
Expression AtlasAT1G66230-
AtGenExpressAT1G66230-
ATTED-IIAT1G66230-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB20).
Function -- GeneRIF ? help Back to Top
  1. AtMYB20 down-regulates the expression of PP2Cs, the negative regulator of ABA signaling, and enhances salt tolerance
    [PMID: 23660402]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G66230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G66230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195650.0AY519565.1 Arabidopsis thaliana MYB transcription factor (At1g66230) mRNA, complete cds.
GenBankBT0289040.0BT028904.1 Arabidopsis thaliana unknown protein (At1g66230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176797.10.0myb domain protein 20
SwissprotQ50EX69e-86ODO1_PETHY; Protein ODORANT1
TrEMBLQ9C7U70.0Q9C7U7_ARATH; At1g66230
STRINGAT1G66230.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  4. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  8. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  9. Zhong R,Richardson EA,Ye ZH
    The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2776-92
    [PMID:17890373]
  10. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  11. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  12. Cui MH, et al.
    An Arabidopsis R2R3-MYB transcription factor, AtMYB20, negatively regulates type 2C serine/threonine protein phosphatases to enhance salt tolerance.
    FEBS Lett., 2013. 587(12): p. 1773-8
    [PMID:23660402]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  14. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]